Recombinant Human ISCA1 Protein, GST-tagged
| Cat.No. : | ISCA1-4605H |
| Product Overview : | Human HBLD2 full-length ORF ( AAH02675, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM |
| Molecular Mass : | 39.93 kDa |
| AA Sequence : | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ISCA1 iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ISCA1 |
| Synonyms | ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2; |
| Gene ID | 81689 |
| mRNA Refseq | NM_030940 |
| Protein Refseq | NP_112202 |
| MIM | 611006 |
| UniProt ID | Q9BUE6 |
| ◆ Recombinant Proteins | ||
| ISCA1-3081Z | Recombinant Zebrafish ISCA1 | +Inquiry |
| ISCA1-165H | Recombinant Human ISCA1, His-tagged | +Inquiry |
| ISCA1-4605H | Recombinant Human ISCA1 Protein, GST-tagged | +Inquiry |
| ISCA1-3241H | Recombinant Human ISCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ISCA1-4618M | Recombinant Mouse ISCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISCA1-5155HCL | Recombinant Human ISCA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISCA1 Products
Required fields are marked with *
My Review for All ISCA1 Products
Required fields are marked with *


