Recombinant Full Length Human ISCA2 Protein, GST-tagged
Cat.No. : | ISCA2-3496HF |
Product Overview : | Human HBLD1 full-length ORF ( NP_919255.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 154 amino acids |
Description : | The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012] |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ISCA2 iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ISCA2 |
Synonyms | ISCA2; iron-sulfur cluster assembly 2 homolog (S. cerevisiae); HBLD1, HesB like domain containing 1; iron-sulfur cluster assembly 2 homolog, mitochondrial; ISA2; HesB like domain containing 1; HESB-like domain-containing protein 1; HBLD1; c14_5557; |
Gene ID | 122961 |
mRNA Refseq | NM_194279 |
Protein Refseq | NP_919255 |
MIM | 615317 |
UniProt ID | Q86U28 |
◆ Recombinant Proteins | ||
ISCA2-3880H | Recombinant Human ISCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Isca2-3582M | Recombinant Mouse Isca2 Protein, Myc/DDK-tagged | +Inquiry |
ISCA2-166H | Recombinant Human ISCA2, GST-tagged | +Inquiry |
ISCA2-2304R | Recombinant Rhesus monkey ISCA2 Protein, His-tagged | +Inquiry |
ISCA2-4619M | Recombinant Mouse ISCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISCA2-5154HCL | Recombinant Human ISCA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISCA2 Products
Required fields are marked with *
My Review for All ISCA2 Products
Required fields are marked with *