Recombinant Human ISCA2 protein, GST-tagged
| Cat.No. : | ISCA2-166H |
| Product Overview : | Recombinant Human ISCA2 protein(1-154 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-154 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ISCA2 iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ISCA2 |
| Synonyms | ISCA2; iron-sulfur cluster assembly 2 homolog (S. cerevisiae); HBLD1, HesB like domain containing 1; iron-sulfur cluster assembly 2 homolog, mitochondrial; ISA2; HesB like domain containing 1; HESB-like domain-containing protein 1; HBLD1; c14_5557; |
| Gene ID | 122961 |
| mRNA Refseq | NM_194279 |
| Protein Refseq | NP_919255 |
| UniProt ID | Q86U28 |
| ◆ Recombinant Proteins | ||
| ISCA2-8324M | Recombinant Mouse ISCA2 Protein | +Inquiry |
| ISCA2-3880H | Recombinant Human ISCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ISCA2-3496HF | Recombinant Full Length Human ISCA2 Protein, GST-tagged | +Inquiry |
| ISCA2-4604H | Recombinant Human ISCA2 Protein, GST-tagged | +Inquiry |
| ISCA2-4619M | Recombinant Mouse ISCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISCA2-5154HCL | Recombinant Human ISCA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISCA2 Products
Required fields are marked with *
My Review for All ISCA2 Products
Required fields are marked with *
