Recombinant Full Length Human ISG15 Protein, C-Flag-tagged

Cat.No. : ISG15-931HFL
Product Overview : Recombinant Full Length Human ISG15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.7 kDa
AA Sequence : MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST VLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY
GLKPLSTVFMNLRLRGGGTEPGGRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein
Protein Pathways : RIG-I-like receptor signaling pathway
Full Length : Full L.
Gene Name ISG15 ISG15 ubiquitin like modifier [ Homo sapiens (human) ]
Official Symbol ISG15
Synonyms G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
Gene ID 9636
mRNA Refseq NM_005101.4
Protein Refseq NP_005092.1
MIM 147571
UniProt ID P05161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISG15 Products

Required fields are marked with *

My Review for All ISG15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon