Recombinant Full Length Human ISG20L2 Protein, C-Flag-tagged
Cat.No. : | ISG20L2-1616HFL |
Product Overview : | Recombinant Full Length Human ISG20L2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39 kDa |
AA Sequence : | MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP PTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ISG20L2 interferon stimulated exonuclease gene 20 like 2 [ Homo sapiens (human) ] |
Official Symbol | ISG20L2 |
Synonyms | HSD38 |
Gene ID | 81875 |
mRNA Refseq | NM_001303095.1 |
Protein Refseq | NP_001290024.1 |
MIM | 611930 |
UniProt ID | Q9H9L3 |
◆ Recombinant Proteins | ||
Isg20l2-3585M | Recombinant Mouse Isg20l2 Protein, Myc/DDK-tagged | +Inquiry |
ISG20L2-5755HF | Recombinant Full Length Human ISG20L2 Protein, GST-tagged | +Inquiry |
ISG20L2-5972Z | Recombinant Zebrafish ISG20L2 | +Inquiry |
ISG20L2-2765H | Recombinant Human ISG20L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ISG20L2-4621M | Recombinant Mouse ISG20L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG20L2-5150HCL | Recombinant Human ISG20L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISG20L2 Products
Required fields are marked with *
My Review for All ISG20L2 Products
Required fields are marked with *
0
Inquiry Basket