Recombinant Full Length Human ISL2 Protein, GST-tagged

Cat.No. : ISL2-5765HF
Product Overview : Human ISL2 full-length ORF ( NP_665804.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 359 amino acids
Description : ISL2 (ISL LIM Homeobox 2) is a Protein Coding gene. Among its related pathways are Neural Stem Cell Differentiation Pathways and Lineage-specific Markers. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is ISL1.
Molecular Mass : 66.2 kDa
AA Sequence : MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ISL2 ISL LIM homeobox 2 [ Homo sapiens ]
Official Symbol ISL2
Synonyms ISL2; ISL LIM homeobox 2; ISL2 transcription factor, LIM/homeodomain, (islet 2); insulin gene enhancer protein ISL-2; FLJ10160; islet-2; ISL2 transcription factor, LIM/homeodomain, (islet-2);
Gene ID 64843
mRNA Refseq NM_145805
Protein Refseq NP_665804
MIM 609481
UniProt ID Q96A47

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISL2 Products

Required fields are marked with *

My Review for All ISL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon