Recombinant Full Length Human ISL2 Protein, GST-tagged
Cat.No. : | ISL2-5765HF |
Product Overview : | Human ISL2 full-length ORF ( NP_665804.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 359 amino acids |
Description : | ISL2 (ISL LIM Homeobox 2) is a Protein Coding gene. Among its related pathways are Neural Stem Cell Differentiation Pathways and Lineage-specific Markers. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is ISL1. |
Molecular Mass : | 66.2 kDa |
AA Sequence : | MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ISL2 ISL LIM homeobox 2 [ Homo sapiens ] |
Official Symbol | ISL2 |
Synonyms | ISL2; ISL LIM homeobox 2; ISL2 transcription factor, LIM/homeodomain, (islet 2); insulin gene enhancer protein ISL-2; FLJ10160; islet-2; ISL2 transcription factor, LIM/homeodomain, (islet-2); |
Gene ID | 64843 |
mRNA Refseq | NM_145805 |
Protein Refseq | NP_665804 |
MIM | 609481 |
UniProt ID | Q96A47 |
◆ Recombinant Proteins | ||
ISL2-3103R | Recombinant Rat ISL2 Protein | +Inquiry |
ISL2-5765HF | Recombinant Full Length Human ISL2 Protein, GST-tagged | +Inquiry |
ISL2-2759R | Recombinant Rat ISL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISL2-5013H | Recombinant Human ISL2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISL2-876HCL | Recombinant Human ISL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISL2 Products
Required fields are marked with *
My Review for All ISL2 Products
Required fields are marked with *
0
Inquiry Basket