Recombinant Full Length Human ITGB2 Protein

Cat.No. : ITGB2-280HF
Product Overview : Recombinant fragment of Human CD18 protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 100 amino acids
Description : The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene.
Form : Liquid
Molecular Mass : 36.630kDa inclusive of tags
AA Sequence : VCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ]
Official Symbol ITGB2
Synonyms ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1
Gene ID 3689
mRNA Refseq NM_000211
Protein Refseq NP_000202
MIM 600065
UniProt ID P05107

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGB2 Products

Required fields are marked with *

My Review for All ITGB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon