Recombinant Full Length Human ITGB2 Protein
Cat.No. : | ITGB2-280HF |
Product Overview : | Recombinant fragment of Human CD18 protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 100 amino acids |
Description : | The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. |
Form : | Liquid |
Molecular Mass : | 36.630kDa inclusive of tags |
AA Sequence : | VCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGB2 |
Synonyms | ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1 |
Gene ID | 3689 |
mRNA Refseq | NM_000211 |
Protein Refseq | NP_000202 |
MIM | 600065 |
UniProt ID | P05107 |
◆ Recombinant Proteins | ||
RFL9256SF | Recombinant Full Length Pig Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
Itgb2-7146R | Recombinant Rat Itgb2 protein, His & T7-tagged | +Inquiry |
ITGB2-5780HF | Recombinant Full Length Human ITGB2 Protein, GST-tagged | +Inquiry |
ITGB2-1052H | Recombinant Human ITGB2 Protein (Gly124-Leu363), N-GST tagged | +Inquiry |
ITGB2-279HF | Recombinant Full Length Human ITGB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket