Recombinant Full Length Human ITGB3BP Protein, C-Flag-tagged
| Cat.No. : | ITGB3BP-1967HFL |
| Product Overview : | Recombinant Full Length Human ITGB3BP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Full Length : | Full L. |
| Gene Name | ITGB3BP integrin subunit beta 3 binding protein [ Homo sapiens (human) ] |
| Official Symbol | ITGB3BP |
| Synonyms | CENPR; NRIF3; TAP20; CENP-R; HSU37139 |
| Gene ID | 23421 |
| mRNA Refseq | NM_014288.5 |
| Protein Refseq | NP_055103.3 |
| MIM | 605494 |
| UniProt ID | Q13352 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3BP Products
Required fields are marked with *
My Review for All ITGB3BP Products
Required fields are marked with *




