Recombinant Full Length Human ITPKA Protein, C-Flag-tagged
Cat.No. : | ITPKA-1222HFL |
Product Overview : | Recombinant Full Length Human ITPKA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of the inositol 1,4,5-trisphosphate 3-kinase is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. It is also a substrate for the cyclic AMP-dependent protein kinase, calcium/calmodulin- dependent protein kinase II, and protein kinase C in vitro. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGL QRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDD LLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKR CSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARE RPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTR SREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAERTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Calcium signaling pathway, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Full Length : | Full L. |
Gene Name | ITPKA inositol-trisphosphate 3-kinase A [ Homo sapiens (human) ] |
Official Symbol | ITPKA |
Synonyms | IP3KA; IP3-3KA |
Gene ID | 3706 |
mRNA Refseq | NM_002220.3 |
Protein Refseq | NP_002211.1 |
MIM | 147521 |
UniProt ID | P23677 |
◆ Recombinant Proteins | ||
ITPKA-2779R | Recombinant Rat ITPKA Protein, His (Fc)-Avi-tagged | +Inquiry |
ITPKA-270H | Recombinant Human ITPKA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Itpka-3620M | Recombinant Mouse Itpka Protein, Myc/DDK-tagged | +Inquiry |
ITPKA-3123R | Recombinant Rat ITPKA Protein | +Inquiry |
ITPKA-190H | Recombinant Human ITPKA, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITPKA Products
Required fields are marked with *
My Review for All ITPKA Products
Required fields are marked with *
0
Inquiry Basket