Recombinant Full Length Human KCNMB2 Protein, GST-tagged

Cat.No. : KCNMB2-6786HF
Product Overview : Human KCNMB2 full-length ORF ( AAH17825, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 235 amino acids
Description : MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.
Molecular Mass : 51.59 kDa
AA Sequence : MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KCNMB2 potassium calcium-activated channel subfamily M regulatory beta subunit 2 [ Homo sapiens (human) ]
Official Symbol KCNMB2
Synonyms KCNMB2; potassium calcium-activated channel subfamily M regulatory beta subunit 2; calcium-activated potassium channel subunit beta-2; BK channel beta subunit 2; BK channel subunit beta-2; MaxiK channel beta 2 subunit; MaxiK channel beta-subunit 2; big potassium channel beta subunit 2; charybdotoxin receptor subunit beta-2; hCG1646471; hbeta2; k(VCA)beta-2; large conductance calcium-activated potassium channel beta 2 subunit; large-conductance Ca2+-activated K+ channel beta2 subunit; potassium channel subfamily M regulatory beta subunit 2; potassium large conductance calcium-activated channel, subfamily M, beta member 2; slo-beta-2
Gene ID 10242
mRNA Refseq NM_181361
Protein Refseq NP_852006
MIM 605214
UniProt ID Q9Y691

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNMB2 Products

Required fields are marked with *

My Review for All KCNMB2 Products

Required fields are marked with *

0
cart-icon