Recombinant Full Length Human KCNMB2 Protein, GST-tagged
| Cat.No. : | KCNMB2-6786HF |
| Product Overview : | Human KCNMB2 full-length ORF ( AAH17825, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 235 amino acids |
| Description : | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described. |
| Molecular Mass : | 51.59 kDa |
| AA Sequence : | MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KCNMB2 potassium calcium-activated channel subfamily M regulatory beta subunit 2 [ Homo sapiens (human) ] |
| Official Symbol | KCNMB2 |
| Synonyms | KCNMB2; potassium calcium-activated channel subfamily M regulatory beta subunit 2; calcium-activated potassium channel subunit beta-2; BK channel beta subunit 2; BK channel subunit beta-2; MaxiK channel beta 2 subunit; MaxiK channel beta-subunit 2; big potassium channel beta subunit 2; charybdotoxin receptor subunit beta-2; hCG1646471; hbeta2; k(VCA)beta-2; large conductance calcium-activated potassium channel beta 2 subunit; large-conductance Ca2+-activated K+ channel beta2 subunit; potassium channel subfamily M regulatory beta subunit 2; potassium large conductance calcium-activated channel, subfamily M, beta member 2; slo-beta-2 |
| Gene ID | 10242 |
| mRNA Refseq | NM_181361 |
| Protein Refseq | NP_852006 |
| MIM | 605214 |
| UniProt ID | Q9Y691 |
| ◆ Recombinant Proteins | ||
| KCNMB2-4750M | Recombinant Mouse KCNMB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCNMB2-273H | Recombinant Human KCNMB2, His-tagged | +Inquiry |
| KCNMB2-8539M | Recombinant Mouse KCNMB2 Protein | +Inquiry |
| KCNMB2-2192Z | Recombinant Zebrafish KCNMB2 | +Inquiry |
| KCNMB2-2187R | Recombinant Rhesus Macaque KCNMB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNMB2-5026HCL | Recombinant Human KCNMB2 293 Cell Lysate | +Inquiry |
| KCNMB2-5027HCL | Recombinant Human KCNMB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNMB2 Products
Required fields are marked with *
My Review for All KCNMB2 Products
Required fields are marked with *
