Recombinant Full Length Human KHDRBS1 Protein, C-Flag-tagged
Cat.No. : | KHDRBS1-312HFL |
Product Overview : | Recombinant Full Length Human KHDRBS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48 kDa |
AA Sequence : | MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR PSLKAPPARPVKGAYREHPYGRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | KHDRBS1 KH RNA binding domain containing, signal transduction associated 1 [ Homo sapiens (human) ] |
Official Symbol | KHDRBS1 |
Synonyms | p62; p68; Sam68 |
Gene ID | 10657 |
mRNA Refseq | NM_006559.3 |
Protein Refseq | NP_006550.1 |
MIM | 602489 |
UniProt ID | Q07666 |
◆ Recombinant Proteins | ||
KHDRBS1-8610M | Recombinant Mouse KHDRBS1 Protein | +Inquiry |
Khdrbs1-3689M | Recombinant Mouse Khdrbs1 Protein, Myc/DDK-tagged | +Inquiry |
KHDRBS1-2899R | Recombinant Rat KHDRBS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KHDRBS1-312HFL | Recombinant Full Length Human KHDRBS1 Protein, C-Flag-tagged | +Inquiry |
KHDRBS1-2877H | Recombinant Human KH domain containing, RNA binding, signal transduction associated 1, GST-tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
KHDRBS1-896HCL | Recombinant Human KHDRBS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KHDRBS1 Products
Required fields are marked with *
My Review for All KHDRBS1 Products
Required fields are marked with *
0
Inquiry Basket