Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Dl2(Kir2Dl2) Protein, His-Tagged
| Cat.No. : | RFL5473HF |
| Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2) Protein (P43627) (22-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-348) |
| Form : | Lyophilized powder |
| AA Sequence : | HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KIR2DL2 |
| Synonyms | KIR2DL2; CD158B1; NKAT6; Killer cell immunoglobulin-like receptor 2DL2; CD158 antigen-like family member B1; MHC class I NK cell receptor; Natural killer-associated transcript 6; NKAT-6; p58 natural killer cell receptor clone CL-43; p58 NK receptor CL-43; |
| UniProt ID | P43627 |
| ◆ Recombinant Proteins | ||
| KIR2DL2-13H | Recombinant Human KIR2DL2 protein, Fc-tagged, Biotin-labeled | +Inquiry |
| KIR2DL2-0317H | Active Recombinant Human KIR2DL2 protein, Fc-tagged | +Inquiry |
| KIR2DL2-627HB | Recombinant Human KIR2DL2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| KIR2DL2-108H | Recombinant Human KIR2DL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KIR2DL2-12H | Active Recombinant Human KIR2DL2 protein, Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL2 Products
Required fields are marked with *
My Review for All KIR2DL2 Products
Required fields are marked with *
