Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 3Dl1(Kir3Dl1) Protein, His-Tagged
| Cat.No. : | RFL12281HF |
| Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1) Protein (P43629) (22-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-444) |
| Form : | Lyophilized powder |
| AA Sequence : | HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KIR3DL1 |
| Synonyms | KIR3DL1; CD158E; NKAT3; NKB1; Killer cell immunoglobulin-like receptor 3DL1; CD158 antigen-like family member E; HLA-BW4-specific inhibitory NK cell receptor; MHC class I NK cell receptor; Natural killer-associated transcript 3; NKAT-3; p70 natural killer |
| UniProt ID | P43629 |
| ◆ Recombinant Proteins | ||
| KIR3DL1-4417H | Recombinant Human Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1 | +Inquiry |
| KIR3DL1-084H | Recombinant Human KIR3DL1 Protein, C-His-tagged | +Inquiry |
| RFL36386RF | Recombinant Full Length Rat Killer Cell Immunoglobulin-Like Receptor 3Dl1(Kir3Dl1) Protein, His-Tagged | +Inquiry |
| KIR3DL1-3261R | Recombinant Rat KIR3DL1 Protein | +Inquiry |
| KIR3DL1-2917R | Recombinant Rat KIR3DL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR3DL1 Products
Required fields are marked with *
My Review for All KIR3DL1 Products
Required fields are marked with *



