Recombinant Human KIR3DL1 Protein, C-His-tagged
Cat.No. : | KIR3DL1-084H |
Product Overview : | Recombinant Human KIR3DL1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | KIR3DL1, receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis. |
Molecular Mass : | ~35 kDa |
AA Sequence : | HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR3DL1 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ] |
Official Symbol | KIR3DL1 |
Synonyms | KIR3DL1; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1; KIR; killer cell immunoglobulin-like receptor 3DL1; AMB11; CD158e1; CD158e1/2; CD158e2; cl 2; cl 11; nkat3; NKB1; NKB1B; NKAT-3; NK-receptor; KIR antigen 3DL1; killer Ig receptor; p70 NK receptor CL-2/CL-11; MHC class I NK cell receptor; CD158 antigen-like family member E; p70 killer cell inhibitory receptor; natural killer-associated transcript 3; HLA-BW4-specific inhibitory NK cell receptor; p70 natural killer cell receptor clones CL-2/CL-11; NKAT3; CD158E1; KIR3DL1/S1; MGC119726; MGC119728; MGC126589; MGC126591; |
Gene ID | 3811 |
mRNA Refseq | NM_013289 |
Protein Refseq | NP_037421 |
MIM | 604946 |
UniProt ID | P43629 |
◆ Recombinant Proteins | ||
KIR3DL1-3261R | Recombinant Rat KIR3DL1 Protein | +Inquiry |
KIR3DL1-2917R | Recombinant Rat KIR3DL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIR3DL1-4343H | Recombinant Human KIR3DL1 Protein (Met1-His340), C-His tagged | +Inquiry |
KIR3DL1-4417H | Recombinant Human Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1 | +Inquiry |
RFL13541MF | Recombinant Full Length Mouse Killer Cell Immunoglobulin-Like Receptor 3Dl1(Kir3Dl1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR3DL1 Products
Required fields are marked with *
My Review for All KIR3DL1 Products
Required fields are marked with *
0
Inquiry Basket