Recombinant Human KIR3DL1 Protein, C-His-tagged
| Cat.No. : | KIR3DL1-084H |
| Product Overview : | Recombinant Human KIR3DL1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | KIR3DL1, receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis. |
| Molecular Mass : | ~35 kDa |
| AA Sequence : | HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | KIR3DL1 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ] |
| Official Symbol | KIR3DL1 |
| Synonyms | KIR3DL1; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1; KIR; killer cell immunoglobulin-like receptor 3DL1; AMB11; CD158e1; CD158e1/2; CD158e2; cl 2; cl 11; nkat3; NKB1; NKB1B; NKAT-3; NK-receptor; KIR antigen 3DL1; killer Ig receptor; p70 NK receptor CL-2/CL-11; MHC class I NK cell receptor; CD158 antigen-like family member E; p70 killer cell inhibitory receptor; natural killer-associated transcript 3; HLA-BW4-specific inhibitory NK cell receptor; p70 natural killer cell receptor clones CL-2/CL-11; NKAT3; CD158E1; KIR3DL1/S1; MGC119726; MGC119728; MGC126589; MGC126591; |
| Gene ID | 3811 |
| mRNA Refseq | NM_013289 |
| Protein Refseq | NP_037421 |
| MIM | 604946 |
| UniProt ID | P43629 |
| ◆ Cell & Tissue Lysates | ||
| KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR3DL1 Products
Required fields are marked with *
My Review for All KIR3DL1 Products
Required fields are marked with *



