Recombinant Human KIR3DL1 Protein, C-His-tagged

Cat.No. : KIR3DL1-084H
Product Overview : Recombinant Human KIR3DL1 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : KIR3DL1, receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
Molecular Mass : ~35 kDa
AA Sequence : HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR3DL1 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ]
Official Symbol KIR3DL1
Synonyms KIR3DL1; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1; KIR; killer cell immunoglobulin-like receptor 3DL1; AMB11; CD158e1; CD158e1/2; CD158e2; cl 2; cl 11; nkat3; NKB1; NKB1B; NKAT-3; NK-receptor; KIR antigen 3DL1; killer Ig receptor; p70 NK receptor CL-2/CL-11; MHC class I NK cell receptor; CD158 antigen-like family member E; p70 killer cell inhibitory receptor; natural killer-associated transcript 3; HLA-BW4-specific inhibitory NK cell receptor; p70 natural killer cell receptor clones CL-2/CL-11; NKAT3; CD158E1; KIR3DL1/S1; MGC119726; MGC119728; MGC126589; MGC126591;
Gene ID 3811
mRNA Refseq NM_013289
Protein Refseq NP_037421
MIM 604946
UniProt ID P43629

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR3DL1 Products

Required fields are marked with *

My Review for All KIR3DL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon