Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 3Dl2(Kir3Dl2) Protein, His-Tagged
Cat.No. : | RFL26840HF |
Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2) Protein (P43630) (22-455aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-455) |
Form : | Lyophilized powder |
AA Sequence : | LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KIR3DL2 |
Synonyms | KIR3DL2; CD158K; NKAT4; Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; MHC class I NK cell receptor; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD |
UniProt ID | P43630 |
◆ Recombinant Proteins | ||
KIR3DL2-4344H | Recombinant Human KIR3DL2 Protein (Met1-His340), C-His tagged | +Inquiry |
KIR3DL2-5708H | Recombinant Human KIR3DL2 protein, His & GST-tagged | +Inquiry |
KIR3DL2-5669H | Active Recombinant Human Killer Cell Immunoglobulin-Like Receptor, Three Domains, Long Cytoplasmic Tail, 2, Fc-tagged | +Inquiry |
KIR3DL2-4345H | Recombinant Human KIR3DL2 Protein (Met1-His338), C-Fc tagged | +Inquiry |
KIR3DL2-3291H | Active Recombinant Human KIR3DL2 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR3DL2-4938HCL | Recombinant Human KIR3DL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR3DL2 Products
Required fields are marked with *
My Review for All KIR3DL2 Products
Required fields are marked with *
0
Inquiry Basket