Recombinant Human KIR3DL2 Protein, C-His-tagged

Cat.No. : KIR3DL2-085H
Product Overview : Recombinant Human KIR3DL2 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4.
Molecular Mass : ~35 kDa
AA Sequence : LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR3DL2 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ]
Official Symbol KIR3DL2
Synonyms KIR3DL2; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 3DL2; CD158K; cl 5; nkat4; nkat4a; nkat4b; KIR antigen 3DL2; killer Ig receptor; p70 NK receptor CL-5; MHC class I NK cell receptor; CD158 antigen-like family member K; p70 killer cell inhibitory receptor; natural killer-associated transcript 4; natural killer cell inhibitory receptor; p70 natural killer cell receptor clone CL-5; killer cell immunoglobulin-like receptor KIR3DL2; p140; NKAT4; NKAT-4; NKAT4B; MGC125321;
Gene ID 3812
mRNA Refseq NM_001242867
Protein Refseq NP_001229796
MIM 604947
UniProt ID P43630

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR3DL2 Products

Required fields are marked with *

My Review for All KIR3DL2 Products

Required fields are marked with *

0
cart-icon