Recombinant Human KIR3DL2 Protein, C-His-tagged
| Cat.No. : | KIR3DL2-085H |
| Product Overview : | Recombinant Human KIR3DL2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4. |
| Molecular Mass : | ~35 kDa |
| AA Sequence : | LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | KIR3DL2 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ] |
| Official Symbol | KIR3DL2 |
| Synonyms | KIR3DL2; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 3DL2; CD158K; cl 5; nkat4; nkat4a; nkat4b; KIR antigen 3DL2; killer Ig receptor; p70 NK receptor CL-5; MHC class I NK cell receptor; CD158 antigen-like family member K; p70 killer cell inhibitory receptor; natural killer-associated transcript 4; natural killer cell inhibitory receptor; p70 natural killer cell receptor clone CL-5; killer cell immunoglobulin-like receptor KIR3DL2; p140; NKAT4; NKAT-4; NKAT4B; MGC125321; |
| Gene ID | 3812 |
| mRNA Refseq | NM_001242867 |
| Protein Refseq | NP_001229796 |
| MIM | 604947 |
| UniProt ID | P43630 |
| ◆ Recombinant Proteins | ||
| KIR3DL2-5669H | Active Recombinant Human Killer Cell Immunoglobulin-Like Receptor, Three Domains, Long Cytoplasmic Tail, 2, Fc-tagged | +Inquiry |
| KIR3DL2-3291H | Active Recombinant Human KIR3DL2 protein, His-Avi-tagged | +Inquiry |
| KIR3DL2-085H | Recombinant Human KIR3DL2 Protein, C-His-tagged | +Inquiry |
| KIR3DL2-3714H | Recombinant Human KIR3DL2 protein, rFc-tagged | +Inquiry |
| KIR3DL2-3292R | Recombinant Rhesus macaque KIR3DL2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIR3DL2-4938HCL | Recombinant Human KIR3DL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR3DL2 Products
Required fields are marked with *
My Review for All KIR3DL2 Products
Required fields are marked with *
