Recombinant Full Length Human KLK7 Protein, GST-tagged
Cat.No. : | KLK7-5864HF |
Product Overview : | Human KLK7 full-length ORF ( NP_005037.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 253 amino acids |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq |
Molecular Mass : | 53.90 kDa |
AA Sequence : | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLK7 kallikrein-related peptidase 7 [ Homo sapiens ] |
Official Symbol | KLK7 |
Synonyms | KLK7; kallikrein-related peptidase 7; kallikrein 7 (chymotryptic, stratum corneum) , PRSS6; kallikrein-7; SCCE; signal protein; serine protease 6; stratum corneum chymotryptic enzyme; kallikrein 7 (chymotryptic, stratum corneum); hK7; PRSS6; |
Gene ID | 5650 |
mRNA Refseq | NM_001243126 |
Protein Refseq | NP_001230055 |
MIM | 604438 |
UniProt ID | P49862 |
◆ Recombinant Proteins | ||
KLK7-1959H | Recombinant Human KLK7 protein, His & GST-tagged | +Inquiry |
KLK7-26893TH | Recombinant Human KLK7 | +Inquiry |
KLK7-4880M | Recombinant Mouse KLK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klk7-3726M | Recombinant Mouse Klk7 Protein, Myc/DDK-tagged | +Inquiry |
KLK7-889H | Recombinant Human KLK7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK7-1421MCL | Recombinant Mouse KLK7 cell lysate | +Inquiry |
KLK7-2428HCL | Recombinant Human KLK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK7 Products
Required fields are marked with *
My Review for All KLK7 Products
Required fields are marked with *
0
Inquiry Basket