Recombinant Full Length Human KLKB1 Protein, GST-tagged
Cat.No. : | KLKB1-5870HF |
Product Overview : | Human KLKB1 full-length ORF (BAG36176.1, 1 a.a. - 638 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 638 amino acids |
Description : | Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma kallikrein therefore is composed of a heavy chain and a light chain held together by a disulphide bond. The heavy chain originates from the amino-terminal end of the zymogen and contains 4 tandem repeats of 90 or 91 amino acids. Each repeat harbors a novel structure called the apple domain. The heavy chain is required for the surface-dependent pro-coagulant activity of plasma kallikrein. The light chain contains the active site or catalytic domain of the enzyme and is homologous to the trypsin family of serine proteases. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients. [provided by RefSeq |
Molecular Mass : | 96.58 kDa |
AA Sequence : | MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLKB1 kallikrein B, plasma (Fletcher factor) 1 [ Homo sapiens ] |
Official Symbol | KLKB1 |
Synonyms | KLKB1; kallikrein B, plasma (Fletcher factor) 1; KLK3; plasma kallikrein; kininogenin; Fletcher factor; plasma prekallikrein; plasma kallikrein heavy chain; plasma kallikrein light chain; PPK; |
Gene ID | 3818 |
mRNA Refseq | NM_000892 |
Protein Refseq | NP_000883 |
MIM | 229000 |
UniProt ID | P03952 |
◆ Recombinant Proteins | ||
KLKB1-1267R | Recombinant Rat KLKB1 Protein, His-tagged | +Inquiry |
KLKB1-605R | Recombinant Rat KLKB1 Protein (391-638 aa), His-tagged | +Inquiry |
KLKB1-4925H | Recombinant Human KLKB1 Protein, GST-tagged | +Inquiry |
KLKB1-3238H | Recombinant Human KLKB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLKB1-483H | Active Recombinant Human Kallikrein B, Plasma (Fletcher factor) 1, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *