Recombinant Full Length Human KLRD1 Protein, GST-tagged
| Cat.No. : | KLRD1-5773HF |
| Product Overview : | Human KLRD1 full-length ORF ( AAH28009, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 179 amino acids |
| Description : | Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 45.43 kDa |
| AA Sequence : | MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ] |
| Official Symbol | KLRD1 |
| Synonyms | KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94; KP43; CD94 antigen; NK cell receptor; |
| Gene ID | 3824 |
| mRNA Refseq | NM_001114396 |
| Protein Refseq | NP_001107868 |
| MIM | 602894 |
| UniProt ID | Q13241 |
| ◆ Recombinant Proteins | ||
| RFL33426RF | Recombinant Full Length Rat Natural Killer Cells Antigen Cd94(Klrd1) Protein, His-Tagged | +Inquiry |
| KLRD1-2381H | Recombinant Human KLRD1 protein(Lys32-Ile179), hFc-tagged | +Inquiry |
| KLRD1-252H | Active Recombinant Human KLRD1 protein, His-tagged | +Inquiry |
| KLRD1-5773HF | Recombinant Full Length Human KLRD1 Protein, GST-tagged | +Inquiry |
| KLRD1-4363H | Recombinant Human KLRD1 Protein (Lys32-Ile179), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRD1 Products
Required fields are marked with *
My Review for All KLRD1 Products
Required fields are marked with *
