Recombinant Full Length Human KPNA1 Protein, C-Flag-tagged
Cat.No. : | KPNA1-1481HFL |
Product Overview : | Recombinant Full Length Human KPNA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. This protein interacts with the recombination activating gene 1 (RAG1) protein and is a putative substrate of the RAG1 ubiquitin ligase. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60 kDa |
AA Sequence : | MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEA QINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKEN CTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMYRDYVLDC NILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSY LSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSP KESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQ EIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KPNA1 karyopherin subunit alpha 1 [ Homo sapiens (human) ] |
Official Symbol | KPNA1 |
Synonyms | RCH2; SRP1; IPOA5; NPI-1 |
Gene ID | 3836 |
mRNA Refseq | NM_002264.4 |
Protein Refseq | NP_002255.3 |
MIM | 600686 |
UniProt ID | P52294 |
◆ Recombinant Proteins | ||
KPNA1-1481HFL | Recombinant Full Length Human KPNA1 Protein, C-Flag-tagged | +Inquiry |
KPNA1-2473C | Recombinant Chicken KPNA1 | +Inquiry |
KPNA1-1446H | Recombinant Human KPNA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KPNA1-8797M | Recombinant Mouse KPNA1 Protein | +Inquiry |
KPNA1-271HF | Recombinant Full Length Human KPNA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA1-4892HCL | Recombinant Human KPNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA1 Products
Required fields are marked with *
My Review for All KPNA1 Products
Required fields are marked with *
0
Inquiry Basket