Recombinant Full Length Human KPNA1 Protein, GST-tagged
Cat.No. : | KPNA1-5792HF |
Product Overview : | Human KPNA1 full-length ORF ( AAH02374.1, 1 a.a. - 538 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 538 amino acids |
Description : | Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq |
Molecular Mass : | 84.92 kDa |
AA Sequence : | MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KPNA1 karyopherin alpha 1 (importin alpha 5) [ Homo sapiens ] |
Official Symbol | KPNA1 |
Synonyms | KPNA1; karyopherin alpha 1 (importin alpha 5); importin subunit alpha-1; IPOA5; NPI 1; RCH2; SRP1; SRP1-beta; importin alpha 5; importin-alpha-S1; RAG cohort protein 2; nucleoprotein interactor 1; karyopherin subunit alpha-1; recombination activating gene cohort 2; NPI-1; |
Gene ID | 3836 |
mRNA Refseq | NM_002264 |
Protein Refseq | NP_002255 |
MIM | 600686 |
UniProt ID | P52294 |
◆ Recombinant Proteins | ||
KPNA1-1313H | Recombinant Human KPNA1 protein, His & T7-tagged | +Inquiry |
Kpna1-1278M | Recombinant Mouse Kpna1 Protein, MYC/DDK-tagged | +Inquiry |
KPNA1-1481HFL | Recombinant Full Length Human KPNA1 Protein, C-Flag-tagged | +Inquiry |
KPNA1-1260H | Recombinant Human KPNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNA1-4895M | Recombinant Mouse KPNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA1-4892HCL | Recombinant Human KPNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA1 Products
Required fields are marked with *
My Review for All KPNA1 Products
Required fields are marked with *