Recombinant Full Length Human KPNA4 Protein, C-Flag-tagged
Cat.No. : | KPNA4-2192HFL |
Product Overview : | Recombinant Full Length Human KPNA4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQN TSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALT NIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP SIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMV IDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL SNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDI DEDPSLVPEAIQGGTFGFNSSANVPTEGFQF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KPNA4 karyopherin subunit alpha 4 [ Homo sapiens (human) ] |
Official Symbol | KPNA4 |
Synonyms | QIP1; SRP3; IPOA3 |
Gene ID | 3840 |
mRNA Refseq | NM_002268.5 |
Protein Refseq | NP_002259.1 |
MIM | 602970 |
UniProt ID | O00629 |
◆ Recombinant Proteins | ||
KPNA4-1811C | Recombinant Chicken KPNA4 | +Inquiry |
KPNA4-11453Z | Recombinant Zebrafish KPNA4 | +Inquiry |
KPNA4-5881H | Recombinant Human KPNA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KPNA4-4898M | Recombinant Mouse KPNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNA4-29909TH | Recombinant Human KPNA4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA4-4889HCL | Recombinant Human KPNA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPNA4 Products
Required fields are marked with *
My Review for All KPNA4 Products
Required fields are marked with *
0
Inquiry Basket