Recombinant Full Length Human KPRP Protein, GST-tagged
| Cat.No. : | KPRP-5842HF |
| Product Overview : | Human KPRP full-length ORF ( NP_001020402.1, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 579 amino acids |
| Description : | This gene encodes a proline-rich skin protein possibly involved in keratinocyte differentiation. [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 90.09 kDa |
| AA Sequence : | MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVSDQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYVQCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQPSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRPRPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIPLPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KPRP keratinocyte proline-rich protein [ Homo sapiens ] |
| Official Symbol | KPRP |
| Synonyms | C1orf45; KPRP; keratinocyte proline-rich protein |
| Gene ID | 448834 |
| mRNA Refseq | NM_001025231 |
| Protein Refseq | NP_001020402 |
| MIM | 613260 |
| UniProt ID | Q5T749 |
| ◆ Recombinant Proteins | ||
| KPRP-4902M | Recombinant Mouse KPRP Protein, His (Fc)-Avi-tagged | +Inquiry |
| KPRP-4890H | Recombinant Human KPRP Protein, GST-tagged | +Inquiry |
| KPRP-8804M | Recombinant Mouse KPRP Protein | +Inquiry |
| KPRP-3305R | Recombinant Rat KPRP Protein | +Inquiry |
| KPRP-5842HF | Recombinant Full Length Human KPRP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPRP Products
Required fields are marked with *
My Review for All KPRP Products
Required fields are marked with *
