Recombinant Full Length Human KRT76 Protein, GST-tagged
| Cat.No. : | KRT76-6090HF |
| Product Overview : | Human KRT76 full-length ORF ( NP_056932.1, 1 a.a. - 638 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 638 amino acids |
| Description : | Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13. [provided by RefSeq |
| Molecular Mass : | 92.3 kDa |
| AA Sequence : | MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRTQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRT76 keratin 76 [ Homo sapiens ] |
| Official Symbol | KRT76 |
| Synonyms | KRT76; keratin 76; keratin, type II cytoskeletal 2 oral; HUMCYT2A; KRT2B; KRT2P; K2P; K76; CK-2P; keratin 2p; keratin-76; cytokeratin 2; cytokeratin-2P; type-II keratin Kb9; |
| Gene ID | 51350 |
| mRNA Refseq | NM_015848 |
| Protein Refseq | NP_056932 |
| MIM | 616671 |
| UniProt ID | Q01546 |
| ◆ Recombinant Proteins | ||
| KRT76-8851M | Recombinant Mouse KRT76 Protein | +Inquiry |
| KRT76-4838H | Recombinant Human KRT76 Protein, GST-tagged | +Inquiry |
| KRT76-4939M | Recombinant Mouse KRT76 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRT76-6090HF | Recombinant Full Length Human KRT76 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRT76-957HCL | Recombinant Human KRT76 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT76 Products
Required fields are marked with *
My Review for All KRT76 Products
Required fields are marked with *



