Recombinant Full Length Human KRT82 Protein, GST-tagged
Cat.No. : | KRT82-6099HF |
Product Overview : | Human KRT82 full-length ORF ( AAI53100.1, 1 a.a. - 513 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 513 amino acids |
Description : | The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin. [provided by RefSeq |
Molecular Mass : | 82.83 kDa |
AA Sequence : | MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT82 keratin 82 [ Homo sapiens ] |
Official Symbol | KRT82 |
Synonyms | KRT82; keratin 82; keratin, hair, basic, 2 , KRTHB2; keratin, type II cuticular Hb2; hard keratin type II 2; Hb 2; K82; keratin-82; type-II keratin Kb22; keratin, hair, basic, 2; hard keratin, type II, 2; type II hair keratin Hb2; HB2; Hb-2; KRTHB2; |
Gene ID | 3888 |
mRNA Refseq | NM_033033 |
Protein Refseq | NP_149022 |
MIM | 601078 |
UniProt ID | Q9NSB4 |
◆ Recombinant Proteins | ||
KRT82-6099HF | Recombinant Full Length Human KRT82 Protein, GST-tagged | +Inquiry |
KRT82-8858M | Recombinant Mouse KRT82 Protein | +Inquiry |
KRT82-4833H | Recombinant Human KRT82 Protein, GST-tagged | +Inquiry |
KRT82-4943M | Recombinant Mouse KRT82 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT82 Products
Required fields are marked with *
My Review for All KRT82 Products
Required fields are marked with *