Recombinant Full Length Human KRTAP12-3 Protein, GST-tagged
Cat.No. : | KRTAP12-3-5800HF |
Product Overview : | Human KRTAP12-3 full-length ORF ( AAI60116.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 96 amino acids |
Description : | KRTAP12-3 (Keratin Associated Protein 12-3) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP12-1. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MCHTSCSPACQPTCCIHSPCQASCYVPVSCQSSVCMPVSCTRIVCVAPSCQPSVCVPVSCRPIIYVTPSCQSSGCCQPPCTTALCRPISCSTPSCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP12-3 keratin associated protein 12-3 [ Homo sapiens (human) ] |
Official Symbol | KRTAP12-3 |
Synonyms | KRTAP12-3; keratin associated protein 12-3; KRTAP12.3; keratin-associated protein 12-3; high sulfur keratin-associated protein 12.3; keratin-associated protein 12.3 |
Gene ID | 386683 |
mRNA Refseq | NM_198697 |
Protein Refseq | NP_941970 |
UniProt ID | P60328 |
◆ Recombinant Proteins | ||
KRTAP12-3-4825H | Recombinant Human KRTAP12-3 Protein, GST-tagged | +Inquiry |
KRTAP12-3-3265H | Recombinant Human KRTAP12-3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP12-3-5800HF | Recombinant Full Length Human KRTAP12-3 Protein, GST-tagged | +Inquiry |
KRTAP12-3-1552H | Recombinant Human KRTAP12-3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP12-3 Products
Required fields are marked with *
My Review for All KRTAP12-3 Products
Required fields are marked with *