Recombinant Full Length Human KRTAP12-3 Protein, GST-tagged

Cat.No. : KRTAP12-3-5800HF
Product Overview : Human KRTAP12-3 full-length ORF ( AAI60116.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 96 amino acids
Description : KRTAP12-3 (Keratin Associated Protein 12-3) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP12-1.
Molecular Mass : 10.6 kDa
AA Sequence : MCHTSCSPACQPTCCIHSPCQASCYVPVSCQSSVCMPVSCTRIVCVAPSCQPSVCVPVSCRPIIYVTPSCQSSGCCQPPCTTALCRPISCSTPSCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP12-3 keratin associated protein 12-3 [ Homo sapiens (human) ]
Official Symbol KRTAP12-3
Synonyms KRTAP12-3; keratin associated protein 12-3; KRTAP12.3; keratin-associated protein 12-3; high sulfur keratin-associated protein 12.3; keratin-associated protein 12.3
Gene ID 386683
mRNA Refseq NM_198697
Protein Refseq NP_941970
UniProt ID P60328

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP12-3 Products

Required fields are marked with *

My Review for All KRTAP12-3 Products

Required fields are marked with *

0
cart-icon