Recombinant Full Length Human KRTAP17-1 Protein, GST-tagged
Cat.No. : | KRTAP17-1-5806HF |
Product Overview : | Human KRTAP17-1 full-length ORF ( AAI46561.1, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 105 amino acids |
Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MGCCPGDCFTCCTQEQNCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSSCCGSGCGGCGGCGGCGGGCCGSSCCGSSCCGSGCCGPVCCQPTPICDTK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP17-1 keratin associated protein 17-1 [ Homo sapiens (human) ] |
Official Symbol | KRTAP17-1 |
Synonyms | KRTAP17-1; keratin associated protein 17-1; KAP17.1; KRTAP16.1; KRTAP17.1; keratin-associated protein 17-1; keratin associated protein 16.1 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=83902 |
mRNA Refseq | NM_031964 |
Protein Refseq | NP_114170 |
UniProt ID | Q9BYP8 |
◆ Recombinant Proteins | ||
KRTAP17-1-3271H | Recombinant Human KRTAP17-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP17-1-1537H | Recombinant Human KRTAP17-1 | +Inquiry |
KRTAP17-1-4820H | Recombinant Human KRTAP17-1 Protein, GST-tagged | +Inquiry |
KRTAP17-1-5806HF | Recombinant Full Length Human KRTAP17-1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP17-1 Products
Required fields are marked with *
My Review for All KRTAP17-1 Products
Required fields are marked with *