Recombinant Full Length Human KRTAP19-4 Protein, GST-tagged
| Cat.No. : | KRTAP19-4-5808HF |
| Product Overview : | Human KRTAP19-4 full-length ORF ( ADR82788.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 84 amino acids |
| Description : | KRTAP19-4 (Keratin Associated Protein 19-4) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
| Molecular Mass : | 9.3 kDa |
| AA Sequence : | MSYYGSYYRGLGYGCGGFGGLGYGYGCGCGSFRRLGYGCGFGGNGYGYCRPSCYGGYGFSILLKSYPEDTISEVIRRSFNLTKY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP19-4 keratin associated protein 19-4 [ Homo sapiens ] |
| Official Symbol | KRTAP19-4 |
| Synonyms | KAP19.4; KRTAP19-4; keratin associated protein 19-4 |
| Gene ID | 337971 |
| mRNA Refseq | NM_181610 |
| Protein Refseq | NP_853641 |
| UniProt ID | Q3LI73 |
| ◆ Recombinant Proteins | ||
| KRTAP19-4-8877M | Recombinant Mouse KRTAP19-4 Protein | +Inquiry |
| KRTAP19-4-5808HF | Recombinant Full Length Human KRTAP19-4 Protein, GST-tagged | +Inquiry |
| KRTAP19-4-4953M | Recombinant Mouse KRTAP19-4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRTAP19-4-4818H | Recombinant Human KRTAP19-4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRTAP19-4-4847HCL | Recombinant Human KRTAP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP19-4 Products
Required fields are marked with *
My Review for All KRTAP19-4 Products
Required fields are marked with *
