Recombinant Full Length Human KRTAP3-3 Protein, GST-tagged
| Cat.No. : | KRTAP3-3-5814HF | 
| Product Overview : | Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 98 amino acids | 
| Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq | 
| Molecular Mass : | 36.8 kDa | 
| AA Sequence : | MDCCASRGCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | KRTAP3-3 keratin associated protein 3-3 [ Homo sapiens (human) ] | 
| Official Symbol | KRTAP3-3 | 
| Synonyms | KRTAP3-3; keratin associated protein 3-3; KAP3.3; KRTAP3.3; keratin-associated protein 3-3; high sulfur keratin-associated protein 3.3; keratin-associated protein 3.3 | 
| Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=85293 | 
| mRNA Refseq | NM_033185 | 
| Protein Refseq | NP_149441 | 
| UniProt ID | Q9BYR6 | 
| ◆ Recombinant Proteins | ||
| KRTAP3-3-5814HF | Recombinant Full Length Human KRTAP3-3 Protein, GST-tagged | +Inquiry | 
| KRTAP3-3-8889M | Recombinant Mouse KRTAP3-3 Protein | +Inquiry | 
| KRTAP3-3-4958M | Recombinant Mouse KRTAP3-3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| KRTAP3-3-3290H | Recombinant Human KRTAP3-3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| KRTAP3-3-4813H | Recombinant Human KRTAP3-3 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP3-3 Products
Required fields are marked with *
My Review for All KRTAP3-3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            