Recombinant Full Length Human KRTAP5-6 Protein, GST-tagged

Cat.No. : KRTAP5-6-5826HF
Product Overview : Human KRTAP5-6 full-length ORF ( ADR83318.1, 1 a.a. - 50 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 50 amino acids
Description : KRTAP5-6 (Keratin Associated Protein 5-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
Molecular Mass : 5.5 kDa
AA Sequence : MGCCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP5-6 keratin associated protein 5-6 [ Homo sapiens (human) ]
Official Symbol KRTAP5-6
Synonyms KRTAP5-6; keratin associated protein 5-6; KRTAP5.6; keratin-associated protein 5-6; keratin-associated protein 5.6; ultrahigh sulfur keratin-associated protein 5.6
Gene ID 440023
mRNA Refseq NM_001012416
Protein Refseq NP_001012416
UniProt ID Q6L8G9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP5-6 Products

Required fields are marked with *

My Review for All KRTAP5-6 Products

Required fields are marked with *

0
cart-icon