Recombinant Full Length Human KRTAP5-7 Protein, GST-tagged
Cat.No. : | KRTAP5-7-5827HF |
Product Overview : | Human KRTAP5-7 full-length ORF ( AAI48791.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 165 amino acids |
Description : | KRTAP5-7 (Keratin Associated Protein 5-7) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MGCCGCSEGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP5-7 keratin associated protein 5-7 [ Homo sapiens (human) ] |
Official Symbol | KRTAP5-7 |
Synonyms | KRTAP5-7; keratin associated protein 5-7; KRTAP5-3; KRTAP5.7; keratin-associated protein 5-7; keratin-associated protein 5-3; keratin-associated protein 5.3; keratin-associated protein 5.7; ultrahigh sulfur keratin-associated protein 5.7 |
Gene ID | 440050 |
mRNA Refseq | NM_001012503 |
Protein Refseq | NP_001012521 |
UniProt ID | Q6L8G8 |
◆ Recombinant Proteins | ||
KRTAP5-7-1584H | Recombinant Human KRTAP5-7 | +Inquiry |
KRTAP5-7-5827HF | Recombinant Full Length Human KRTAP5-7 Protein, GST-tagged | +Inquiry |
KRTAP5-7-4807H | Recombinant Human KRTAP5-7 Protein, GST-tagged | +Inquiry |
KRTAP5-7-3305H | Recombinant Human KRTAP5-7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP5-7 Products
Required fields are marked with *
My Review for All KRTAP5-7 Products
Required fields are marked with *