Recombinant Full Length Human KRTAP5-8 Protein, GST-tagged

Cat.No. : KRTAP5-8-5828HF
Product Overview : Human KRTAP5-8 full-length ORF ( AAI60147.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 187 amino acids
Description : KRTAP5-8 (Keratin Associated Protein 5-8) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. GO annotations related to this gene include structural constituent of epidermis.
Molecular Mass : 20.6 kDa
AA Sequence : MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP5-8 keratin associated protein 5-8 [ Homo sapiens (human) ]
Official Symbol KRTAP5-8
Synonyms KRTAP5-8; keratin associated protein 5-8; UHSKerB; KRTAP5-2; KRTAP5.8; keratin-associated protein 5-8; UHS KERB-like protein; UHS KerB; UHS keratin B; keratin, ultra high-sulfur matrix protein B; keratin, ultrahigh sulfur, B; keratin-associated protein 5.8; ultrahigh sulfur keratin-associated protein 5.8
Gene ID 57830
mRNA Refseq NM_021046
Protein Refseq NP_066384
UniProt ID O75690

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP5-8 Products

Required fields are marked with *

My Review for All KRTAP5-8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon