Recombinant Full Length Human KRTAP5-8 Protein, GST-tagged
| Cat.No. : | KRTAP5-8-5828HF |
| Product Overview : | Human KRTAP5-8 full-length ORF ( AAI60147.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 187 amino acids |
| Description : | KRTAP5-8 (Keratin Associated Protein 5-8) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. GO annotations related to this gene include structural constituent of epidermis. |
| Molecular Mass : | 20.6 kDa |
| AA Sequence : | MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCKI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP5-8 keratin associated protein 5-8 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP5-8 |
| Synonyms | KRTAP5-8; keratin associated protein 5-8; UHSKerB; KRTAP5-2; KRTAP5.8; keratin-associated protein 5-8; UHS KERB-like protein; UHS KerB; UHS keratin B; keratin, ultra high-sulfur matrix protein B; keratin, ultrahigh sulfur, B; keratin-associated protein 5.8; ultrahigh sulfur keratin-associated protein 5.8 |
| Gene ID | 57830 |
| mRNA Refseq | NM_021046 |
| Protein Refseq | NP_066384 |
| UniProt ID | O75690 |
| ◆ Recombinant Proteins | ||
| KRTAP5-8-5828HF | Recombinant Full Length Human KRTAP5-8 Protein, GST-tagged | +Inquiry |
| KRTAP5-8-4806H | Recombinant Human KRTAP5-8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP5-8 Products
Required fields are marked with *
My Review for All KRTAP5-8 Products
Required fields are marked with *
