Recombinant Full Length Human Lamina-Associated Polypeptide 2, Isoforms Beta/Gamma(Tmpo) Protein, His-Tagged
Cat.No. : | RFL21636HF |
Product Overview : | Recombinant Full Length Human Lamina-associated polypeptide 2, isoforms beta/gamma(TMPO) Protein (P42167) (2-454aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-454) |
Form : | Lyophilized powder |
AA Sequence : | PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKG PPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLL DQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSD RYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKGG PLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTGN FKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISA SCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLFV VVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMPO |
Synonyms | TMPO; LAP2; Lamina-associated polypeptide 2, isoforms beta/gamma; Thymopoietin, isoforms beta/gamma; TP beta/gamma; Thymopoietin-related peptide isoforms beta/gamma; TPRP isoforms beta/gamma |
UniProt ID | P42167 |
◆ Recombinant Proteins | ||
TMPO-185H | Recombinant Human TMPO Protein, HIS-tagged | +Inquiry |
TMPO-6468H | Recombinant Human TMPO Protein (Met1-Leu243), N-His tagged | +Inquiry |
TMPO-1382C | Recombinant Chicken TMPO | +Inquiry |
RFL10142MF | Recombinant Full Length Mouse Lamina-Associated Polypeptide 2, Isoforms Beta/Delta/Epsilon/Gamma(Tmpo) Protein, His-Tagged | +Inquiry |
TMPO-4219H | Recombinant Human TMPO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPO-912HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
TMPO-913HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPO Products
Required fields are marked with *
My Review for All TMPO Products
Required fields are marked with *