Recombinant Full Length Human LCN6 Protein, C-Flag-tagged

Cat.No. : LCN6-1468HFL
Product Overview : Recombinant Full Length Human LCN6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable small molecule binding activity. Predicted to be involved in single fertilization. Predicted to be located in extracellular region.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.9 kDa
AA Sequence : MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLT
ETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein
Full Length : Full L.
Gene Name LCN6 lipocalin 6 [ Homo sapiens (human) ]
Official Symbol LCN6
Synonyms LCN5; hLcn5; UNQ643
Gene ID 158062
mRNA Refseq NM_198946.3
Protein Refseq NP_945184.1
MIM 609379
UniProt ID P62502

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN6 Products

Required fields are marked with *

My Review for All LCN6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon