Recombinant Full Length Human LCN6 Protein, C-Flag-tagged
| Cat.No. : | LCN6-1468HFL |
| Product Overview : | Recombinant Full Length Human LCN6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable small molecule binding activity. Predicted to be involved in single fertilization. Predicted to be located in extracellular region. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 17.9 kDa |
| AA Sequence : | MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLT ETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | LCN6 lipocalin 6 [ Homo sapiens (human) ] |
| Official Symbol | LCN6 |
| Synonyms | LCN5; hLcn5; UNQ643 |
| Gene ID | 158062 |
| mRNA Refseq | NM_198946.3 |
| Protein Refseq | NP_945184.1 |
| MIM | 609379 |
| UniProt ID | P62502 |
| ◆ Recombinant Proteins | ||
| Lcn6-3761M | Recombinant Mouse Lcn6 Protein, Myc/DDK-tagged | +Inquiry |
| Lcn6-1149R | Recombinant Rat Lcn6 protein, His & GST-tagged | +Inquiry |
| LCN6-1280H | Recombinant Human LCN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LCN6-1468HFL | Recombinant Full Length Human LCN6 Protein, C-Flag-tagged | +Inquiry |
| LCN6-2389H | Recombinant Human LCN6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LCN6-4799HCL | Recombinant Human LCN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN6 Products
Required fields are marked with *
My Review for All LCN6 Products
Required fields are marked with *



