Recombinant Full Length Human LCN6 Protein, C-Flag-tagged

• Cat.No.: LCN6-1468HFL
• Product Overview: Recombinant Full Length Human LCN6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable small molecule binding activity. Predicted to be involved in single fertilization. Predicted to be located in extracellular region.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 17.9 kDa
• AA Sequence: MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLT
  ETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: LCN6 lipocalin 6 [ Homo sapiens (human) ]
• Official Symbol: LCN6
• Synonyms: LCN5; hLcn5; UNQ643
• Gene ID: 158062
• mRNA Refseq: NM_198946.3
• Protein Refseq: NP_945184.1
• MIM: 609379
• UniProt ID: P62502