Recombinant Full Length Human LCP2 Protein, C-Flag-tagged
Cat.No. : | LCP2-587HFL |
Product Overview : | Recombinant Full Length Human LCP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an adapter protein that acts as a substrate of the T cell antigen receptor (TCR)-activated protein tyrosine kinase pathway. The encoded protein associates with growth factor receptor bound protein 2, and is thought to play a role TCR-mediated intracellular signal transduction. A similar protein in mouse plays a role in normal T-cell development and activation. Mice lacking this gene show subcutaneous and intraperitoneal fetal hemorrhaging, dysfunctional platelets and impaired viability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60 kDa |
AA Sequence : | MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Full Length : | Full L. |
Gene Name | LCP2 lymphocyte cytosolic protein 2 [ Homo sapiens (human) ] |
Official Symbol | LCP2 |
Synonyms | IMD81; SLP76; SLP-76 |
Gene ID | 3937 |
mRNA Refseq | NM_005565.5 |
Protein Refseq | NP_005556.1 |
MIM | 601603 |
UniProt ID | Q13094 |
◆ Recombinant Proteins | ||
Lcp2-1304M | Recombinant Mouse Lcp2 Protein, MYC/DDK-tagged | +Inquiry |
LCP2-299H | Recombinant Human LCP2 Protein, His-tagged | +Inquiry |
LCP2-2483R | Recombinant Rhesus monkey LCP2 Protein, His-tagged | +Inquiry |
LCP2-9015M | Recombinant Mouse LCP2 Protein | +Inquiry |
LCP2-587HFL | Recombinant Full Length Human LCP2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCP2 Products
Required fields are marked with *
My Review for All LCP2 Products
Required fields are marked with *
0
Inquiry Basket