Recombinant Human LCP2 Protein, His-tagged
Cat.No. : | LCP2-299H |
Product Overview : | Recombinant Human LCP2 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Involved in T-cell antigen receptor mediated signaling. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, 20%glycerol, pH8.5 |
Molecular Mass : | 62.6kD |
AA Sequence : | MASMTGGQQMGRGSMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKP |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ] |
Official Symbol | LCP2 |
Synonyms | LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain containing leukocyte protein of 76kD; SLP 76; SLP-76 tyrosine phosphoprotein; SH2 domain-containing leukocyte protein of 76kD; SH2 domain-containing leukocyte protein of 76 kDa; SLP76; SLP-76; |
Gene ID | 3937 |
mRNA Refseq | NM_005565 |
Protein Refseq | NP_005556 |
MIM | 601603 |
UniProt ID | Q13094 |
◆ Recombinant Proteins | ||
LCP2-1282H | Recombinant Human LCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCP2-299H | Recombinant Human LCP2 Protein, His-tagged | +Inquiry |
Lcp2-1304M | Recombinant Mouse Lcp2 Protein, MYC/DDK-tagged | +Inquiry |
LCP2-281HF | Recombinant Full Length Human LCP2 Protein | +Inquiry |
LCP2-587HFL | Recombinant Full Length Human LCP2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCP2 Products
Required fields are marked with *
My Review for All LCP2 Products
Required fields are marked with *
0
Inquiry Basket