Recombinant Human LCP2 Protein, His-tagged
| Cat.No. : | LCP2-299H |
| Product Overview : | Recombinant Human LCP2 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Involved in T-cell antigen receptor mediated signaling. |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, 20%glycerol, pH8.5 |
| Molecular Mass : | 62.6kD |
| AA Sequence : | MASMTGGQQMGRGSMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKP |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ] |
| Official Symbol | LCP2 |
| Synonyms | LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain containing leukocyte protein of 76kD; SLP 76; SLP-76 tyrosine phosphoprotein; SH2 domain-containing leukocyte protein of 76kD; SH2 domain-containing leukocyte protein of 76 kDa; SLP76; SLP-76; |
| Gene ID | 3937 |
| mRNA Refseq | NM_005565 |
| Protein Refseq | NP_005556 |
| MIM | 601603 |
| UniProt ID | Q13094 |
| ◆ Recombinant Proteins | ||
| LCP2-281HF | Recombinant Full Length Human LCP2 Protein | +Inquiry |
| LCP2-587HFL | Recombinant Full Length Human LCP2 Protein, C-Flag-tagged | +Inquiry |
| LCP2-299H | Recombinant Human LCP2 Protein, His-tagged | +Inquiry |
| Lcp2-5810M | Recombinant Mouse Lcp2 protein, His & T7-tagged | +Inquiry |
| Lcp2-1304M | Recombinant Mouse Lcp2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCP2 Products
Required fields are marked with *
My Review for All LCP2 Products
Required fields are marked with *
