Recombinant Full Length Human LCTL Protein, C-Flag-tagged
Cat.No. : | LCTL-1508HFL |
Product Overview : | Recombinant Full Length Human LCTL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of family 1 glycosidases. Glycosidases are enzymes that hydrolyze glycosidic bonds and are classified into families based on primary amino acid sequence. Most members of family 1 have two conserved glutamic acid residues, which are required for enzymatic activity. The mouse ortholog of this protein has been characterized and has a domain structure of an N-terminal signal peptide, glycosidase domain, transmembrane domain, and a short cytoplasmic tail. It lacks one of the conserved glutamic acid residues important for catalysis, and its function remains to be determined. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.9 kDa |
AA Sequence : | MKPVWVATLLWMLLLVPRLGAARKGSPEEASFYYGTFPLGFSWGVGSSAYQTEGAWDQDGKGPSIWDVFT HSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSWPRLLPTGIRAEQVNKKGIEFYSDLID ALLSSNITPIVTLHHWDLPQLLQVKYGGWQNVSMANYFRDYANLCFEAFGDRVKHWITFSDPRAMAEKGY ETGHHAPGLKLRGTGLYKAAHHIIKAHAKAWHSYNTTWRSKQQGLVGISLNCDWGEPVDISNPKDLEAAE RYLQFCLGWFANPIYAGDYPQVMKDYIGRKSAEQGLEMSRLPVFSLQEKSYIKGTSDFLGLGHFTTRYIT ERNYPSRQGPSYQNDRDLIELVDPNWPDLGSKWLYSVPWGFRRLLNFAQTQYGDPPIYVMENGASQKFHC TQLCDEWRIQYLKGYINEMLKAIKDGANIKGYTSWSLLDKFEWEKGYSDRYGFYYVEFNDRNKPRYPKAS VQYYKKIIIANGFPNPREVESWYLKALETCSINNQMLAAEPLLSHMQMVTEIVVPTVCSLCVLITAVLLM LLLRRQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | LCTL lactase like [ Homo sapiens (human) ] |
Official Symbol | LCTL |
Synonyms | KLG; KLPH |
Gene ID | 197021 |
mRNA Refseq | NM_207338.4 |
Protein Refseq | NP_997221.2 |
MIM | 617060 |
UniProt ID | Q6UWM7 |
◆ Recombinant Proteins | ||
Lctl-7643M | Recombinant Mouse Lctl protein, His&Myc-tagged | +Inquiry |
LCTL-530H | Recombinant Human LCTL, His-tagged | +Inquiry |
LCTL-3730H | Recombinant Human LCTL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LCTL-1283H | Recombinant Human LCTL Protein, His (Fc)-Avi-tagged | +Inquiry |
LCTL-9016M | Recombinant Mouse LCTL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCTL-4793HCL | Recombinant Human LCTL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCTL Products
Required fields are marked with *
My Review for All LCTL Products
Required fields are marked with *
0
Inquiry Basket