Recombinant Full Length Human LINC00173 Protein, GST-tagged

• Cat.No.: LINC00173-4913HF
• Product Overview: Human FLJ42957 full-length ORF ( NP_997319.1, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 143 amino acids
• Description: LINC00173 (Long Intergenic Non-Protein Coding RNA 173) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 42.8 kDa
• AA Sequence: MSFSPYSTMITVCVCFNSRVQLTVPSFTAWLRSRYSKALFMVLRRAAQEKDKGVCQGWHCVKKWACKGRIPGQPLQPQPLGPYLRSLSQHPATQTPRPQARASSRYLELHRSQNRGGSEFKFWFCYCLIACCRDSISSSGKWE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC00173 long intergenic non-protein coding RNA 173 [ Homo sapiens (human) ]
• Official Symbol: LINC00173
• Synonyms: LINC00173; long intergenic non-protein coding RNA 173; NCRNA00173; FLJ42957; MGC148154; MGC148155
• Gene ID: 100287569
• UniProt ID: Q6ZV60