Recombinant Full Length Human Lipoma Hmgic Fusion Partner-Like 2 Protein(Lhfpl2) Protein, His-Tagged
Cat.No. : | RFL20482HF |
Product Overview : | Recombinant Full Length Human Lipoma HMGIC fusion partner-like 2 protein(LHFPL2) Protein (Q6ZUX7) (1-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-228) |
Form : | Lyophilized powder |
AA Sequence : | MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPT LGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVF TMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCS LGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LHFPL2 |
Synonyms | LHFPL2; KIAA0206; LHFPL tetraspan subfamily member 2 protein; Lipoma HMGIC fusion partner-like 2 protein |
UniProt ID | Q6ZUX7 |
◆ Recombinant Proteins | ||
LHFPL2-2508R | Recombinant Rhesus monkey LHFPL2 Protein, His-tagged | +Inquiry |
RFL20482HF | Recombinant Full Length Human Lipoma Hmgic Fusion Partner-Like 2 Protein(Lhfpl2) Protein, His-Tagged | +Inquiry |
LHFPL2-5069M | Recombinant Mouse LHFPL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LHFPL2-2574H | Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LHFPL2-524H | Recombinant Human LHFPL2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHFPL2 Products
Required fields are marked with *
My Review for All LHFPL2 Products
Required fields are marked with *