Recombinant Full Length Human LMNB1 Protein, C-Flag-tagged
Cat.No. : | LMNB1-1638HFL |
Product Overview : | Recombinant Full Length Human LMNB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.2 kDa |
AA Sequence : | MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR DQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA AGVVVEEELFHQQGTPRASNRSCAIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LMNB1 lamin B1 [ Homo sapiens (human) ] |
Official Symbol | LMNB1 |
Synonyms | LMN; ADLD; LMN2; LMNB; MCPH26 |
Gene ID | 4001 |
mRNA Refseq | NM_005573.4 |
Protein Refseq | NP_005564.1 |
MIM | 150340 |
UniProt ID | P20700 |
◆ Recombinant Proteins | ||
LMNB1-3428R | Recombinant Rat LMNB1 Protein | +Inquiry |
LMNB1-5117M | Recombinant Mouse LMNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMNB1-9154M | Recombinant Mouse LMNB1 Protein | +Inquiry |
LMNB1-28298TH | Recombinant Human LMNB1 | +Inquiry |
LMNB1-2353R | Recombinant Rhesus Macaque LMNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMNB1-994HCL | Recombinant Human LMNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMNB1 Products
Required fields are marked with *
My Review for All LMNB1 Products
Required fields are marked with *
0
Inquiry Basket