Recombinant Full Length Human LOC162137 Protein, GST-tagged
| Cat.No. : | LOC162137-6399HF |
| Product Overview : | Human MGC34800 full-length ORF ( AAH29861.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 173 amino acids |
| Description : | LOC162137 (Uncharacterized LOC162137) is an RNA Gene, and is affiliated with the ncRNA class. |
| Molecular Mass : | 43.8 kDa |
| AA Sequence : | MGDLPWAPPEAQAPSTAGAGDVAEHQVAPARFLQGAWRQAAGWLCRETGAAPGSAQAGPPETAHAADPQPRGPQAPPRLPPSLSPERVHPGQPAAPAEPAPGAPALRSGPSQPRGLRLPVPVPACAGSSAPGSPAALPDSYPWPPPARNRPATLPPTSRVSPLAAFLASAPQR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LOC162137 uncharacterized LOC162137 [ Homo sapiens (human) ] |
| Official Symbol | LOC162137 |
| Synonyms | LOC162137; uncharacterized LOC162137; CTD-2144E22.5 |
| Gene ID | 162137 |
| ◆ Recombinant Proteins | ||
| LOC162137-5273H | Recombinant Human LOC162137 Protein, GST-tagged | +Inquiry |
| LOC162137-6399HF | Recombinant Full Length Human LOC162137 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC162137 Products
Required fields are marked with *
My Review for All LOC162137 Products
Required fields are marked with *
