Recombinant Human LOC162137 Protein, GST-tagged

• Cat.No.: LOC162137-5273H
• Product Overview: Human MGC34800 full-length ORF ( AAH29861.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC162137 (Uncharacterized LOC162137) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 43.8 kDa
• AA Sequence: MGDLPWAPPEAQAPSTAGAGDVAEHQVAPARFLQGAWRQAAGWLCRETGAAPGSAQAGPPETAHAADPQPRGPQAPPRLPPSLSPERVHPGQPAAPAEPAPGAPALRSGPSQPRGLRLPVPVPACAGSSAPGSPAALPDSYPWPPPARNRPATLPPTSRVSPLAAFLASAPQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC162137 uncharacterized LOC162137 [ Homo sapiens (human) ]
• Official Symbol: LOC162137
• Synonyms: LOC162137; uncharacterized LOC162137; CTD-2144E22.5
• Gene ID: 162137