Recombinant Full Length Human LPO Protein, GST-tagged
Cat.No. : | LPO-5996HF |
Product Overview : | Human LPO full-length ORF (1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 177 amino acids |
Description : | This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MSSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRWRGLGCGGRPFQPLRPALPRPLSLGHSRQICHCLAHLGWRSHLPHLLKIARLQPSPSSPLCVSGSGTFPRGGGAPRLQGVGAVQRPQI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LPO lactoperoxidase [ Homo sapiens ] |
Official Symbol | LPO |
Synonyms | LPO; lactoperoxidase; SPO; salivary peroxidase; MGC129990; MGC129991; |
Gene ID | 4025 |
mRNA Refseq | NM_001160102 |
Protein Refseq | NP_001153574 |
MIM | 150205 |
UniProt ID | P22079 |
◆ Recombinant Proteins | ||
LPO-855H | Recombinant Human LPO Protein, MYC/DDK-tagged | +Inquiry |
LPO-2808H | Recombinant Human LPO Protein (Val283-Asn702), His tagged | +Inquiry |
LPO-390H | Recombinant Human LPO Protein, His/GST-tagged | +Inquiry |
LPO-5034H | Recombinant Human LPO protein, His&Myc-tagged | +Inquiry |
LPO-4042H | Recombinant Human LPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPO Products
Required fields are marked with *
My Review for All LPO Products
Required fields are marked with *
0
Inquiry Basket