Recombinant Human LPO Protein, GST-tagged
| Cat.No. : | LPO-4714H |
| Product Overview : | Human LPO full-length ORF (1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MSSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRWRGLGCGGRPFQPLRPALPRPLSLGHSRQICHCLAHLGWRSHLPHLLKIARLQPSPSSPLCVSGSGTFPRGGGAPRLQGVGAVQRPQI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LPO lactoperoxidase [ Homo sapiens ] |
| Official Symbol | LPO |
| Synonyms | LPO; lactoperoxidase; SPO; salivary peroxidase; MGC129990; MGC129991; |
| Gene ID | 4025 |
| mRNA Refseq | NM_001160102 |
| Protein Refseq | NP_001153574 |
| MIM | 150205 |
| UniProt ID | P22079 |
| ◆ Recombinant Proteins | ||
| LPO-2808H | Recombinant Human LPO Protein (Val283-Asn702), His tagged | +Inquiry |
| LPO-4454H | Recombinant Human LPO Protein (Val283-Asn712), N-His tagged | +Inquiry |
| LPO-4714H | Recombinant Human LPO Protein, GST-tagged | +Inquiry |
| LPO-1093H | Recombinant Human LPO Protein, His&SUMO-tagged | +Inquiry |
| LPO-5034H | Recombinant Human LPO protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPO Products
Required fields are marked with *
My Review for All LPO Products
Required fields are marked with *



