Recombinant Full Length Human LRP1 Protein, GST-tagged
Cat.No. : | LRP1-6011HF |
Product Overview : | Human LRP1 full-length ORF ( AAH45107.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 292 amino acids |
Description : | This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients. [provided by RefSeq, Oct 2015] |
Molecular Mass : | 58 kDa |
AA Sequence : | MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRP1 low density lipoprotein receptor-related protein 1 [ Homo sapiens ] |
Official Symbol | LRP1 |
Synonyms | LRP1; low density lipoprotein receptor-related protein 1; A2MR, alpha 2 macroglobulin receptor , APR; prolow-density lipoprotein receptor-related protein 1; CD91; LRP; LRP-1; type V tgf-beta receptor; apolipoprotein E receptor; alpha-2-macroglobulin receptor; TbetaR-V/LRP-1/IGFBP-3 receptor; APR; A2MR; APOER; TGFBR5; IGFBP3R; FLJ16451; MGC88725; |
Gene ID | 4035 |
mRNA Refseq | NM_002332 |
Protein Refseq | NP_002323 |
MIM | 107770 |
UniProt ID | Q07954 |
◆ Recombinant Proteins | ||
LRP1-0712H | Recombinant Human LRP1 Protein (Ala20-His280), N-His tagged | +Inquiry |
Lrp1-5721M | Recombinant Mouse Lrp1 protein, His & T7-tagged | +Inquiry |
LRP1-6010HF | Recombinant Full Length Human LRP1 Protein | +Inquiry |
LRP1-6011HF | Recombinant Full Length Human LRP1 Protein, GST-tagged | +Inquiry |
Lrp1-5722M | Recombinant Mouse Lrp1 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRP1-2217HCL | Recombinant Human LRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRP1 Products
Required fields are marked with *
My Review for All LRP1 Products
Required fields are marked with *
0
Inquiry Basket