Recombinant Full Length Human LRRC55 Protein, GST-tagged
Cat.No. : | LRRC55-6060HF |
Product Overview : | Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 341 amino acids |
Description : | LRRC55 (Leucine Rich Repeat Containing 55) is a Protein Coding gene. An important paralog of this gene is LRRC38. |
Molecular Mass : | 64 kDa |
AA Sequence : | MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC55 leucine rich repeat containing 55 [ Homo sapiens ] |
Official Symbol | LRRC55 |
Synonyms | LRRC55; leucine rich repeat containing 55 |
Gene ID | 219527 |
mRNA Refseq | NM_001005210 |
Protein Refseq | NP_001005210 |
MIM | 615213 |
UniProt ID | Q6ZSA7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC55 Products
Required fields are marked with *
My Review for All LRRC55 Products
Required fields are marked with *