Recombinant Full Length Human LRRC55 Protein, GST-tagged

Cat.No. : LRRC55-6060HF
Product Overview : Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 341 amino acids
Description : LRRC55 (Leucine Rich Repeat Containing 55) is a Protein Coding gene. An important paralog of this gene is LRRC38.
Molecular Mass : 64 kDa
AA Sequence : MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC55 leucine rich repeat containing 55 [ Homo sapiens ]
Official Symbol LRRC55
Synonyms LRRC55; leucine rich repeat containing 55
Gene ID 219527
mRNA Refseq NM_001005210
Protein Refseq NP_001005210
MIM 615213
UniProt ID Q6ZSA7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC55 Products

Required fields are marked with *

My Review for All LRRC55 Products

Required fields are marked with *

0
cart-icon
0
compare icon