Recombinant Full Length Human LRRC55 Protein, GST-tagged
| Cat.No. : | LRRC55-6060HF | 
| Product Overview : | Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 341 amino acids | 
| Description : | LRRC55 (Leucine Rich Repeat Containing 55) is a Protein Coding gene. An important paralog of this gene is LRRC38. | 
| Molecular Mass : | 64 kDa | 
| AA Sequence : | MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | LRRC55 leucine rich repeat containing 55 [ Homo sapiens ] | 
| Official Symbol | LRRC55 | 
| Synonyms | LRRC55; leucine rich repeat containing 55 | 
| Gene ID | 219527 | 
| mRNA Refseq | NM_001005210 | 
| Protein Refseq | NP_001005210 | 
| MIM | 615213 | 
| UniProt ID | Q6ZSA7 | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC55 Products
Required fields are marked with *
My Review for All LRRC55 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            