Recombinant Full Length Human LRRN1 Protein, C-Flag-tagged
Cat.No. : | LRRN1-17HFL |
Product Overview : | Recombinant Full Length Human LRRN1 Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | Predicted to act upstream of or within positive regulation of synapse assembly. Predicted to be integral component of membrane. Predicted to be active in extracellular matrix and extracellular space. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 80.5 kDa |
AA Sequence : | MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPSLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Gene Name | LRRN1 leucine rich repeat neuronal 1 [ Homo sapiens (human) ] |
Official Symbol | LRRN1 |
Synonyms | LRRN1; FIGLER3; NLRR-1; NLRR1; leucine rich repeat neuronal 1 |
Gene ID | 57633 |
mRNA Refseq | NM_020873.7 |
Protein Refseq | NP_065924.3 |
MIM | 619623 |
UniProt ID | Q6UXK5 |
◆ Recombinant Proteins | ||
LRRN1-2570R | Recombinant Rhesus monkey LRRN1 Protein, His-tagged | +Inquiry |
LRRN1-5213M | Recombinant Mouse LRRN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRN1-32HFL | Recombinant Full Length Human LRRN1 Protein, C-Myc/DDK-tagged | +Inquiry |
LRRN1-6079HF | Recombinant Full Length Human LRRN1 Protein, GST-tagged | +Inquiry |
LRRN1-4561H | Recombinant Human LRRN1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRN1-4619HCL | Recombinant Human LRRN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRN1 Products
Required fields are marked with *
My Review for All LRRN1 Products
Required fields are marked with *
0
Inquiry Basket