Recombinant Full Length Human LRRN1 Protein, C-Flag-tagged
| Cat.No. : | LRRN1-17HFL |
| Product Overview : | Recombinant Full Length Human LRRN1 Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Flag |
| Description : | Predicted to act upstream of or within positive regulation of synapse assembly. Predicted to be integral component of membrane. Predicted to be active in extracellular matrix and extracellular space. |
| Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
| Molecular Mass : | 80.5 kDa |
| AA Sequence : | MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPSLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
| Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Gene Name | LRRN1 leucine rich repeat neuronal 1 [ Homo sapiens (human) ] |
| Official Symbol | LRRN1 |
| Synonyms | LRRN1; FIGLER3; NLRR-1; NLRR1; leucine rich repeat neuronal 1 |
| Gene ID | 57633 |
| mRNA Refseq | NM_020873.7 |
| Protein Refseq | NP_065924.3 |
| MIM | 619623 |
| UniProt ID | Q6UXK5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRN1 Products
Required fields are marked with *
My Review for All LRRN1 Products
Required fields are marked with *
Recently Viewed
