Recombinant Full Length Human LSM14A Protein, GST-tagged

Cat.No. : LSM14A-6137HF
Product Overview : Human LSM14A full-length ORF ( AAH16842.1, 1 a.a. - 463 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 463 amino acids
Description : Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
Molecular Mass : 77 kDa
AA Sequence : MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSM14A LSM14A, SCD6 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol LSM14A
Synonyms LSM14A; LSM14A, SCD6 homolog A (S. cerevisiae); C19orf13, chromosome 19 open reading frame 13 , FAM61A, family with sequence similarity 61, member A , LSM14 homolog A (SCD6, S. cerevisiae); protein LSM14 homolog A; DKFZP434D1335; RAP55; RAP55A; hRAP55; hRAP55A; alphaSNBP; LSM14 homolog A; protein SCD6 homolog; RNA-associated protein 55; RNA-associated protein 55A; putative alpha-synuclein-binding protein; family with sequence similarity 61, member A; FAM61A; C19orf13; DKFZp434D1335;
Gene ID 26065
mRNA Refseq NM_001114093
Protein Refseq NP_001107565
MIM 610677
UniProt ID Q8ND56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM14A Products

Required fields are marked with *

My Review for All LSM14A Products

Required fields are marked with *

0
cart-icon