Recombinant Full Length Human LSM14A Protein, GST-tagged
Cat.No. : | LSM14A-6137HF |
Product Overview : | Human LSM14A full-length ORF ( AAH16842.1, 1 a.a. - 463 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 463 amino acids |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Molecular Mass : | 77 kDa |
AA Sequence : | MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM14A LSM14A, SCD6 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LSM14A |
Synonyms | LSM14A; LSM14A, SCD6 homolog A (S. cerevisiae); C19orf13, chromosome 19 open reading frame 13 , FAM61A, family with sequence similarity 61, member A , LSM14 homolog A (SCD6, S. cerevisiae); protein LSM14 homolog A; DKFZP434D1335; RAP55; RAP55A; hRAP55; hRAP55A; alphaSNBP; LSM14 homolog A; protein SCD6 homolog; RNA-associated protein 55; RNA-associated protein 55A; putative alpha-synuclein-binding protein; family with sequence similarity 61, member A; FAM61A; C19orf13; DKFZp434D1335; |
Gene ID | 26065 |
mRNA Refseq | NM_001114093 |
Protein Refseq | NP_001107565 |
MIM | 610677 |
UniProt ID | Q8ND56 |
◆ Recombinant Proteins | ||
Lsm14a-3854M | Recombinant Mouse Lsm14a Protein, Myc/DDK-tagged | +Inquiry |
LSM14A-2580R | Recombinant Rhesus monkey LSM14A Protein, His-tagged | +Inquiry |
LSM14A-6137HF | Recombinant Full Length Human LSM14A Protein, GST-tagged | +Inquiry |
LSM14A-3036H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LSM14A-2007C | Recombinant Chicken LSM14A | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM14A-4609HCL | Recombinant Human LSM14A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSM14A Products
Required fields are marked with *
My Review for All LSM14A Products
Required fields are marked with *
0
Inquiry Basket