Recombinant Full Length Human LSM2 Protein, GST-tagged

Cat.No. : LSM2-5993HF
Product Overview : Human LSM2 full-length ORF (AAH09192.1, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 95 amino acids
Description : Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
Molecular Mass : 36.85 kDa
AA Sequence : MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSM2 LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ]
Official Symbol LSM2
Synonyms LSM2; LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated; G7B; snRNP; C6orf28; YBL026W; U6 snRNA-associated Sm-like protein LSm2; LSM2 U6 small nuclear RNA and mRNA degradation associated; LSM2 homolog, U6 small nuclear RNA associated; protein G7b; small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=57819
mRNA Refseq NM_021177
Protein Refseq NP_067000
MIM 607282
UniProt ID Q9Y333

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM2 Products

Required fields are marked with *

My Review for All LSM2 Products

Required fields are marked with *

0
cart-icon