Recombinant Full Length Human LSM2 Protein, GST-tagged
Cat.No. : | LSM2-5993HF |
Product Overview : | Human LSM2 full-length ORF (AAH09192.1, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 95 amino acids |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Molecular Mass : | 36.85 kDa |
AA Sequence : | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM2 LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ] |
Official Symbol | LSM2 |
Synonyms | LSM2; LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated; G7B; snRNP; C6orf28; YBL026W; U6 snRNA-associated Sm-like protein LSm2; LSM2 U6 small nuclear RNA and mRNA degradation associated; LSM2 homolog, U6 small nuclear RNA associated; protein G7b; small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=57819 |
mRNA Refseq | NM_021177 |
Protein Refseq | NP_067000 |
MIM | 607282 |
UniProt ID | Q9Y333 |
◆ Recombinant Proteins | ||
LSM2-2582R | Recombinant Rhesus monkey LSM2 Protein, His-tagged | +Inquiry |
LSM2-5993HF | Recombinant Full Length Human LSM2 Protein, GST-tagged | +Inquiry |
LSM2-5225M | Recombinant Mouse LSM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM2-9331M | Recombinant Mouse LSM2 Protein | +Inquiry |
LSM2-4612H | Recombinant Human LSM2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM2-9175HCL | Recombinant Human LSM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM2 Products
Required fields are marked with *
My Review for All LSM2 Products
Required fields are marked with *