Recombinant Full Length Human LSM8 Protein, GST-tagged
| Cat.No. : | LSM8-6049HF |
| Product Overview : | Human LSM8 full-length ORF (BAG34877.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 96 amino acids |
| Description : | This gene is a member of the LSm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeq |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSM8 LSM8 homolog, U6 small nuclear RNA associated [ Homo sapiens (human) ] |
| Official Symbol | LSM8 |
| Synonyms | LSM8; LSM8 homolog, U6 small nuclear RNA associated; NAA38; LSM8 homolog, U6 small nuclear RNA associated; LSM8 U6 small nuclear RNA associated; MAK31-like protein; N-alpha-acetyltransferase 38, NatC auxiliary subunit; U6 snRNA-associated Sm-like protein LSm8 |
| Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=51691 |
| mRNA Refseq | NM_016200 |
| Protein Refseq | NP_057284 |
| MIM | 607288 |
| UniProt ID | O95777 |
| ◆ Recombinant Proteins | ||
| LSM8-4604H | Recombinant Human LSM8 Protein, GST-tagged | +Inquiry |
| LSM8-2407R | Recombinant Rhesus Macaque LSM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LSM8-666C | Recombinant Cynomolgus LSM8 Protein, His-tagged | +Inquiry |
| LSM8-4772C | Recombinant Chicken LSM8 | +Inquiry |
| LSM8-8502Z | Recombinant Zebrafish LSM8 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM8 Products
Required fields are marked with *
My Review for All LSM8 Products
Required fields are marked with *
