Recombinant Full Length Human LSM8 Protein, GST-tagged
Cat.No. : | LSM8-6049HF |
Product Overview : | Human LSM8 full-length ORF (BAG34877.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 96 amino acids |
Description : | This gene is a member of the LSm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeq |
Molecular Mass : | 36.96 kDa |
AA Sequence : | MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSM8 LSM8 homolog, U6 small nuclear RNA associated [ Homo sapiens (human) ] |
Official Symbol | LSM8 |
Synonyms | LSM8; LSM8 homolog, U6 small nuclear RNA associated; NAA38; LSM8 homolog, U6 small nuclear RNA associated; LSM8 U6 small nuclear RNA associated; MAK31-like protein; N-alpha-acetyltransferase 38, NatC auxiliary subunit; U6 snRNA-associated Sm-like protein LSm8 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=51691 |
mRNA Refseq | NM_016200 |
Protein Refseq | NP_057284 |
MIM | 607288 |
UniProt ID | O95777 |
◆ Recombinant Proteins | ||
LSM8-6049HF | Recombinant Full Length Human LSM8 Protein, GST-tagged | +Inquiry |
LSM8-2407R | Recombinant Rhesus Macaque LSM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM8-8502Z | Recombinant Zebrafish LSM8 | +Inquiry |
LSM8-2587R | Recombinant Rhesus monkey LSM8 Protein, His-tagged | +Inquiry |
LSM8-4604H | Recombinant Human LSM8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM8 Products
Required fields are marked with *
My Review for All LSM8 Products
Required fields are marked with *