Recombinant Full Length Human LSM8 Protein, GST-tagged

Cat.No. : LSM8-6049HF
Product Overview : Human LSM8 full-length ORF (BAG34877.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 96 amino acids
Description : This gene is a member of the LSm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeq
Molecular Mass : 36.96 kDa
AA Sequence : MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSM8 LSM8 homolog, U6 small nuclear RNA associated [ Homo sapiens (human) ]
Official Symbol LSM8
Synonyms LSM8; LSM8 homolog, U6 small nuclear RNA associated; NAA38; LSM8 homolog, U6 small nuclear RNA associated; LSM8 U6 small nuclear RNA associated; MAK31-like protein; N-alpha-acetyltransferase 38, NatC auxiliary subunit; U6 snRNA-associated Sm-like protein LSm8
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=51691
mRNA Refseq NM_016200
Protein Refseq NP_057284
MIM 607288
UniProt ID O95777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSM8 Products

Required fields are marked with *

My Review for All LSM8 Products

Required fields are marked with *

0
cart-icon
0
compare icon